PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009799718.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 233aa    MW: 27369.1 Da    PI: 9.3589
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009799718.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR177.13.5e-2436124190
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     ++YneYA++vGFsvrk++ +++k+ g +t+r+ +C keg+r+++k+k ++ ++ r etrtg +a++ v++++ gk+++tk++leHnH+l+
  XP_009799718.1  36 NYYNEYARRVGFSVRKEYINTNKELGYVTSRKITCFKEGFRRDDKRK-DQVKKLRRETRTGYQAHIIVTRHSMGKYHITKVKLEHNHALV 124
                     69******************************************999.999*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-2136124IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MCENSPEEVL QSNSQGTVDY EPKLGLEFDS DKDALNYYNE YARRVGFSVR KEYINTNKEL  60
GYVTSRKITC FKEGFRRDDK RKDQVKKLRR ETRTGYQAHI IVTRHSMGKY HITKVKLEHN  120
HALVSPTMIH MLPSHRRINE VQAHEIDLAE DVGLFSKTTF DFMSLQDGGR VNLGYTKLNQ  180
KNYLRTKRQK AMRRGEAGVL LEYFEKKRIE DPSLFFAVQL DVDDMITNIF WTD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17581RRDDKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799718.11e-176PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30211740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-35FAR1-related sequence 5